NPT2C Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02935-1

  The mean SLC34A3 concentration was determined to be 3,807.34 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load, 4,074.78 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load, 3,855.17 ng/mL in A431 cell extract based on a 1.20 mg/mL extract load and 250.95 ng/mL in U-937 cell extract based on a 2.60 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02935-1

  Sandwich ELISA standard curve of MP02935-1, Human SLC34A3 Recombinant Matched Antibody Pair - PBS only. 83139-5-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5835. 83139-4-PBS was HRP conjugated as the detection antibody. Range: 7.81-500 ng/mL.

NPT2C Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83139-4-PBS

Clone No.252167H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

83139-4-PBS targets NPT2C as part of a matched antibody pair:

MP02935-1: 83139-5-PBS capture and 83139-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5835

  Product name: Recombinant human NPT2C protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 220-320 aa of NM_001177316.2

  Sequence: SELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTD

• Full Name: solute carrier family 34 (sodium phosphate), member 3
• Calculated Molecular Weight: 63 kDa
• GenBank Accession Number: NM_001177316.2
• Gene Symbol: SLC34A3
• Gene ID (NCBI): 142680
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N130
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.