NR1D2 Polyclonal antibody

• 

  WB analysis using 13906-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13906-1-AP (NR1D2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13906-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13906-1-AP (NR1D2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13906-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13906-1-AP (NR1D2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13906-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13906-1-AP (NR1D2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 13906-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using NR1D2 antibody (13906-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

NR1D2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13906-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BD73, EAR 1R, EAR-1R, Rev erb beta, Rev-erb alpha-related receptor

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse colon tissue, rat colon tissue
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 2 publications below

Product Information

13906-1-AP targets NR1D2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4881

  Product name: Recombinant human NR1D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC045613

  Sequence: MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYT

• Full Name: nuclear receptor subfamily 1, group D, member 2
• Calculated Molecular Weight: 579 aa, 65 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC045613
• Gene Symbol: NR1D2
• Gene ID (NCBI): 9975
• RRID: AB_2877986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR1D2 (Nuclear Receptor Subfamily 1 Group D Member 2), also known as Rev-erbβ, is a nuclear receptor that functions as a heme-dependent transcriptional repressor and plays a critical role in regulating circadian rhythms and metabolic homeostasis. As an integral component of the circadian clock, NR1D2 forms a negative feedback loop by repressing the expression of core clock genes such as BMAL1 and CLOCK. It exerts its repressive function by binding to specific DNA response elements and recruiting corepressor complexes like NCOR1/HDAC3. Beyond its role in circadian regulation, NR1D2 is involved in lipid and energy metabolism, inflammatory responses, and mitochondrial function. The protein is widely expressed in tissues such as skeletal muscle, brown adipose tissue, and the heart, where it helps coordinate physiological processes with the daily light-dark cycle.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Sci Rep; The functional and predictive roles of miR-210 in cryptorchidism.; Authors - Zhengzheng Duan
mouse	WB	Am J Physiol Heart Circ Physiol; Differential effects of REV-ERBα/β agonism on cardiac gene expression, metabolism, and contractile function in a mouse model of circadian disruption.; Authors - Sobuj Mia
human	WB	Xenobiotica; Identification of rhythmic human CYPs and their circadian regulators using synchronized hepatoma cells.; Authors - Min Chen
rat,human	WB	NPJ Biofilms Microbiomes; Alleviation of Limosilactobacillus reuteri in polycystic ovary syndrome protects against circadian dysrhythmia-induced dyslipidemia via capric acid and GALR1 signaling; Authors - Shang Li
human	WB	Cell Death Dis; SR9009 inhibits lethal prostate cancer subtype 1 by regulating the LXRα/FOXM1 pathway independently of REV-ERBs; Authors - Hang Xu ; KD Validated
mouse	IHC	J Biomed Sci; Secretome from estrogen-responding human placenta-derived mesenchymal stem cells rescues ovarian function and circadian rhythm in mice with cyclophosphamide-induced primary ovarian insufficiency; Authors - Duy-Cuong Le