NR2F6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86371-1-RR (same clone as 86371-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86371-1-RR (NR2F6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86371-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 86371-1-RR (same clone as 86371-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using NR2F6 antibody (86371-1-RR, Clone: 251076E2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86371-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86371-1-RR (same clone as 86371-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NR2F6 antibody (86371-1-RR, Clone: 251076E2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86371-1-PBS in a different storage buffer formulation.

NR2F6 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86371-1-PBS

Clone No.251076E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EAR 2, EAR2, EAR-2, ERBAL2, V erbA related protein 2

---

Product Information

86371-1-PBS targets NR2F6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7614

  Product name: Recombinant human NR2F6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC002669

  Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

• Full Name: nuclear receptor subfamily 2, group F, member 6
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC002669
• Gene Symbol: NR2F6
• Gene ID (NCBI): 2063
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development (PMID:15875024). NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) (PMID: 12690040). It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity (PMID:18701084).