NR4A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NR4A1 Polyclonal antibody (25851-1-AP)

• Featured Product
• KD/KO Validated

NR4A1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 25851-1-AP Copied!

Publications (31)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Early response protein NAK1, GFRP1, HMR, N10, NAK 1, NAK1, NGFIB, NR4A1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST 59, Testicular receptor 3, TR3

• 

  WB analysis of PC-3 using 25851-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25851-1-AP (NR4A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25851-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25851-1-AP (NR4A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 25851-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25851-1-AP (NR4A1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 25851-1-AP

  IP result of anti-NR4A1 (IP:25851-1-AP, 4ug; Detection:25851-1-AP 1:500) with HeLa cells lysate 1720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 25851-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 25851-1-AP (NR4A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 25851-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 25851-1-AP (NR4A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NR4A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, PC-3 cells, HepG2 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25851-1-AP targets NR4A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23088

  Product name: Recombinant human NR4A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-269 aa of BC016147

  Sequence: MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAV

• Full Name: nuclear receptor subfamily 4, group A, member 1
• Calculated Molecular Weight: 598 aa, 64 kDa
• Observed Molecular Weight: 64-68 kDa
• GenBank Accession Number: BC016147
• Gene Symbol: NR4A1
• Gene ID (NCBI): 3164
• RRID: AB_2880269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NR4A1 Polyclonal antibody (Cat# 25851-1-AP) has 31 citations spanning 31 journals, including Cancer Letters, J Med Chem, FASEB J, Mol Med, iScience, and Front Immunol. Research fields cover oncology (colorectal cancer, HCC, mycosis fungoides), neurology (spinal cord injury, stroke, TBI), fibrosis (renal, atrial), cardiovascular disease (atherosclerosis, cardiomyopathy), immunology, nephrology, oral health, and metabolic regulation. Applications include WB, IHC, IF, and IP across human, mouse, rat, and other species.

Automatically generated from the 31 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Genes Dis; The effect of NR4A1 on APP metabolism and tau phosphorylation.; Authors - Li-Ge Zhao
human,mouse	WB	Cancer Lett; NR4A1 depletion inhibits colorectal cancer progression by promoting necroptosis via the RIG-I-like receptor pathway; Authors - Jinghan Zhu
rat	IF	Phytomedicine; Stigmasterol upregulates immediate early genes and promotes neuronal cytoarchitecture in primary hippocampal neurons as revealed by transcriptome analysis.; Authors - Md Nazmul Haque
human,mouse	WB,IHC,IF	Mol Med; Nr4a1 promotes renal interstitial fibrosis by regulating the p38 MAPK phosphorylation; Authors - Yilin Tao ; KD Validated
human	WB,IP,IF	J Med Chem; Structure-Based Design and Optimization of Bi-Aryl Amide Derivatives as Nur77 Ligands for Nur77-Bcl-2-Dependent Apoptotic Cancer Therapy.; Authors - Taige Zhao ; KD Validated
human	IHC,IF	Front Immunol; The cancer-associated fibroblasts interact with malignant T cells in mycosis fungoides and promote the disease progression; Authors - Yige Zhao

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Able is busy answering your previous question. Please try again later.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Angela (Verified Customer) (06-23-2020)

35ug total protein/lane1- Untransfected HEK2932- Transfection with human NR4A1 expression vector3- Transfection with rat NR4A1 expression vector

• Applications: Western Blot
• Primary Antibody Dilution: 500x
• Cell Tissue Type: HEK293

NR4A1 Antibody Western Blot validation (500x dilution) in HEK293 (Cat no:25851-1-AP)