NRAP Polyclonal antibody

• 

  WB analysis using 25977-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25977-1-AP (NRAP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25977-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25977-1-AP (NRAP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 25977-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25977-1-AP (NRAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 25977-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25977-1-AP (NRAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NRAP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25977-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

N RAP, NRAP

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25977-1-AP targets NRAP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23254

  Product name: Recombinant human NRAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1309-1393 aa of BC126407

  Sequence: RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE

• Full Name: nebulin-related anchoring protein
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC126407
• Gene Symbol: NRAP
• Gene ID (NCBI): 4892
• RRID: AB_2918098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRAP (Nebulin-related-anchoring protein) is a striated muscle-specific protein that is concentrated at intercalated disks in cardiac muscle and at myotendinous junctions in skeletal muscle. NRAP is a 197 kDa multidomain scaffolding protein from nebulin family with many interation partners such as α-actinin, actin, vinculin and filamin (PMID:21276443). During cardiomyocyte development in the foetal heart, NRAP is involved in myofibrillar assembly and links terminal actin filaments to membrane complexes in the adult heart. Several studies observed that NRAP mutation would contributed to the dilated cardiomyopathy which is a highly heterogeneous disease with almost 100 candidates genes to date (PMID:28611399).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lainey (Verified Customer) (09-23-2025)

The tested antibody concentration worked perfectly for my samples, so no optimization was needed.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: mouse muscle