NRAS Monoclonal antibody

• 

  WB analysis using 60934-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60934-3-Ig (NRAS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

NRAS Monoclonal Antibody for WB, ELISA

Cat No. 60934-3-Ig

Clone No.2E9E7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, ELISA

Synonyms

HRAS1, EC:3.6.5.2, GTPase NRas, N ras, NRAS1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, C6 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60934-3-Ig targets NRAS in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29746

  Product name: Recombinant human NRAS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-189 aa of BC005219

  Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

• Full Name: neuroblastoma RAS viral (v-ras) oncogene homolog
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005219
• Gene Symbol: NRAS
• Gene ID (NCBI): 4893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01111
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML).