NRAS Recombinant monoclonal antibody

• 

  WB analysis using 83815-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83815-2-RR (NRAS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 83815-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83815-2-RR (NRAS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 83815-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83815-2-RR (NRAS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 83815-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83815-2-RR (NRAS antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83815-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83815-2-RR against Human NRAS were performed. The affinity constant is 0.152 nM.

NRAS Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83815-2-RR

Clone No.242810G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

HRAS1, EC:3.6.5.2, GTPase NRas, N ras, NRAS1

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: mouse testis tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83815-2-RR targets NRAS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1081

  Product name: Recombinant human NRAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC005219

  Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

• Full Name: neuroblastoma RAS viral (v-ras) oncogene homolog
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005219
• Gene Symbol: NRAS
• Gene ID (NCBI): 4893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01111
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML). NRAS is one member of RAS gene family of oncoproteins, which is commonly mutated in melanoma and hematopoietic cancers via mapped on chromosome 1 (PMID: 2327491, PMID: 26990546). NRAS mediates activation of both mitogen-activated protein kinase (MAPK) and PI3K/AKT/MYC signaling (PMID: 17297468). NRAS induced classical MAPK signaling leads to cyclin D1 expression and cell cycle dysregulation and promotion of prosurvival pathways (PMID:7970723,PMID: 18246127). In addition, NRAS effectively prevents Glycogen Synthase Kinase3 (GSK3)-mediated phosphorylation of MYC via PI3K/AKT, which results in enhanced activity of endogenous MYC protein (PMID: 17297468). Mutational NRAS causes Ras-GTP to be in a state of continuous activation, which results in malignant proliferation and metastasis (PMID: 24985059).