NRG4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRG4 Polyclonal antibody, PBS Only (27292-1-PBS)

• 

  WB analysis using 27292-1-AP (same clone as 27292-1-PBS)

  Recombinant human NRG4 protein Eg0997 was subjected to SDS PAGE followed by western blot with 27292-1-AP (NRG4 antibody) at dilution of 1:3000 and incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 27292-1-AP (same clone as 27292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27292-1-AP (NRG4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 27292-1-AP (same clone as 27292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27292-1-AP (NRG4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27292-1-AP (same clone as 27292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27292-1-AP (NRG4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27292-1-AP (same clone as 27292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27292-1-AP (NRG4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27292-1-PBS in a different storage buffer formulation.

NRG4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27292-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

27292-1-PBS targets NRG4 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26044

  Product name: Recombinant human NRG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-62 aa of BC017568

  Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

• Full Name: neuregulin 4
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC017568
• Gene Symbol: NRG4
• Gene ID (NCBI): 145957
• RRID: AB_3669591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuregulin 4 (Nrg4), a member of the epidermal growth factor (EGF) family of extracellular ligands, is expressed in multiple organs with the highest expression levels in brown adipose tissue. Neuregulin 4 is a secreted adipokine recently identified as playing an important role in modulating systemic energy metabolism and in the development of metabolic disorders in rodent and human obesity, including type 2 diabetes and non-alcoholic fatty liver disease (NAFLD). Nrg4 attenuates hepatic lipogenic signaling and preserves glucose and lipid homeostasis in obesity.