NRIP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NRIP3 Polyclonal antibody (15664-1-AP)

• 

  WB analysis of MCF-7 using 15664-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 15664-1-AP (NRIP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15664-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15664-1-AP (NRIP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse ovary using 15664-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 15664-1-AP (NRIP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 15664-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15664-1-AP (NRIP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 15664-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15664-1-AP (NRIP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 15664-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 15664-1-AP (NRIP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NRIP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15664-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C11orf14, NRIP3, NY SAR 105, Sarcoma antigen NY SAR 105

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: mouse ovary tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

15664-1-AP targets NRIP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8097

  Product name: Recombinant human NRIP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC008835

  Sequence: MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEA

• Full Name: nuclear receptor interacting protein 3
• Calculated Molecular Weight: 241 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008835
• Gene Symbol: NRIP3
• Gene ID (NCBI): 56675
• RRID: AB_2878165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ35
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Res Sq; Novel Pathological Mechanisms Revealed by Spatial Transcriptomic Analysis of Hippocampus in Aged Control, Primary Age-Related Tauopathy, and Alzheimer's Disease.; Authors - Hong-Wen Deng