NRK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NRK1 Polyclonal antibody (23805-1-AP)

• 

  WB analysis using 23805-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23805-1-AP (NRK1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 23805-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23805-1-AP (NRK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 23805-1-AP

  IP result of anti-NRK1 (IP:23805-1-AP, 4ug; Detection:23805-1-AP 1:3000) with mouse kidney tissue lysate 3400 ug.

NRK1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 23805-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

C9orf95, Nicotinamide riboside kinase 1, NMRK1, Ribosylnicotinic acid kinase 1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse liver tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23805-1-AP targets NRK1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20746

  Product name: Recombinant human C9orf95 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-199 aa of BC001366

  Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

• Full Name: chromosome 9 open reading frame 95
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001366
• Gene Symbol: C9orf95
• Gene ID (NCBI): 54981
• RRID: AB_3742091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NWW6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRK1 (Nicotinamide riboside kinase 1) is necessary and rate-limiting for the use of exogenous NR and NMN for NAD þ synthesis. Functionally, NRK1 activity restrains CD4+ T cell activation and cytokine production and promotes survival. These activities are linked to increased NRK1 expression in the cytoplasm, where it locally elevates NAD/H levels (PMID: 27725675, 29678570).