NRL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NRL Polyclonal antibody (17388-1-AP)

NRL Polyclonal Antibody for IHC, ELISA

Cat No. 17388-1-AP

Publications(3)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

D14S46E, neural retina leucine zipper, NRL, NRL MAF, RP27

• 

  WB analysis of Transfected HEK-293 using 17388-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 17388-1-AP (NRL Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human retinoblastoma using 17388-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 17388-1-AP (NRL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human retinoblastoma using 17388-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 17388-1-AP (NRL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human retinoblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17388-1-AP targets NRL in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11277

  Product name: Recombinant human NRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC012395

  Sequence: MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL

• Full Name: neural retina leucine zipper
• Calculated Molecular Weight: 237 aa, 26 kDa
• GenBank Accession Number: BC012395
• Gene Symbol: NRL
• Gene ID (NCBI): 4901
• RRID: AB_2878400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54845
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Human brain organoids assemble functionally integrated bilateral optic vesicles.; Authors - Elke Gabriel
mouse	WB	JCI Insight; All-in-one AAV-mediated Nrl gene inactivation rescues retinal degeneration in Pde6a mice; Authors - Zhiquan Liu
human	IF	Nat Protoc; Generation of iPSC-derived human forebrain organoids assembling bilateral eye primordia; Authors - Elke Gabriel

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Zhiquan (Verified Customer) (01-12-2024)

This anti-NRL antibody works well for WB in P30 Mouse retina.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse retina P30

NRL Antibody Western Blot validation (1:1000 dilution) in Mouse retina P30 (Cat no:17388-1-AP)

Alessandro (Verified Customer) (01-19-2023)

great outcome, no unspecific staining

• Applications: Immunofluorescence