NRSN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRSN2 Polyclonal antibody, PBS Only (17574-1-PBS)

• 

  WB analysis of human brain using 17574-1-AP (same clone as 17574-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17574-1-AP (NRSN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17574-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 17574-1-AP (same clone as 17574-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17574-1-AP (NRSN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17574-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17574-1-AP (same clone as 17574-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17574-1-AP (NRSN2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17574-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17574-1-AP (same clone as 17574-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17574-1-AP (NRSN2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17574-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NRSN2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17574-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17574-1-PBS targets NRSN2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10387

  Product name: Recombinant human NRSN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-204 aa of BC001963

  Sequence: MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS

• Full Name: neurensin 2
• Calculated Molecular Weight: 204 aa, 22 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC001963
• Gene Symbol: NRSN2
• Gene ID (NCBI): 80023
• RRID: AB_2155379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.