NSMAF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NSMAF Polyclonal antibody, PBS Only (19407-1-PBS)

• 

  WB analysis using 19407-1-AP (same clone as 19407-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19407-1-AP (NSMAF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19407-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 19407-1-AP (same clone as 19407-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 19407-1-AP (NSMAF antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19407-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 19407-1-AP (same clone as 19407-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 19407-1-AP (NSMAF antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19407-1-PBS in a different storage buffer formulation.

NSMAF Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19407-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Protein FAN, FAN, Factor associated with N-SMase activation

---

Product Information

19407-1-PBS targets NSMAF in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5730

  Product name: Recombinant human NSMAF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 568-917 aa of BC041124

  Sequence: FVTPHPRRITPKFKSLSQTSSYNASMADSPGEESFEDLTEESKTLAWNNITKLQLHEHYKIHKEAVTGITVSRNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYSIAFGRRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTISLNAASTLLVSGTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLISSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQIIFWKLQY

• Full Name: neutral sphingomyelinase (N-SMase) activation associated factor
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 100-104 kDa
• GenBank Accession Number: BC041124
• Gene Symbol: NSMAF
• Gene ID (NCBI): 8439
• RRID: AB_3085576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92636
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NSMAF is a WD-repeat protein that binds the cytoplasmic sphingomyelinase activation domain of the 55kD tumor necrosis factor receptor. This protein is required for TNF-mediated activation of neutral sphingomyelinase and may play a role in regulating TNF-induced cellular responses such as inflammation.