NSUN5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NSUN5 Polyclonal antibody (15449-1-AP)

• Featured Product
• KD/KO Validated

NSUN5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15449-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, RIP, ELISA

Synonyms

28S rRNA (cytosine-C(5))-methyltransferase, EC:2.1.1.-, NOL1, NOL1R, NOL1-related protein

• 

  WB analysis of HeLa using 15449-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15449-1-AP (NSUN5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15449-1-AP

  WB result of NSUN5 antibody (15449-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NSUN5 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 15449-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15449-1-AP (NSUN5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 15449-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15449-1-AP (NSUN5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 15449-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15449-1-AP (NSUN5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15449-1-AP (NSUN5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15449-1-AP (NSUN5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 15449-1-AP (NSUN5 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 15449-1-AP (NSUN5 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15449-1-AP (NSUN5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 15449-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15449-1-AP (NSUN5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NSUN5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, human kidney tissue, human placenta tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human placenta tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15449-1-AP targets NSUN5 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7711

  Product name: Recombinant human NSUN5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-466 aa of BC008084

  Sequence: RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT

• Full Name: NOL1/NOP2/Sun domain family, member 5
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC008084
• Gene Symbol: NSUN5
• Gene ID (NCBI): 55695
• RRID: AB_2153808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P11
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NSUN5 is a conserved RNA methyltransferase belonging to the Nop2/SUN domain family, which is highly conserved from archaea to eukaryotes and has close contact with RNA methylation because of their S-adenosyl methionine binding-domain. NSUN5 was a promoter in the progression of CRC mainly through cell cycle regulation (PMID: 32774740). Loss of NSUN5 induces growth phenotypes in mice and different mammalian cells, which is likely connected to the requirement of NSUN5 for ribosomal RNA modification and normal global protein translation, especially in highly proliferative cells (PMID: 31722427). Western blot analysis detected NSUN5 at an apparent molecular mass of 47 kDa.

Publications

What published studies show

NSUN5 Polyclonal Antibody (Cat# 15449-1-AP) has 17 citations published in journals including Nature Communications, Molecular Cell, Nature Chemical Biology, Cell Death & Disease, FASEB Journal, and others. Research fields encompass RNA m5C modification, ferroptosis, multiple cancers (colorectal, bladder, gastric, hepatocellular, head and neck), and neuroscience (cortical development, cognition, anxiety).

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Epitranscriptomic subtyping, visualization, and denoising by global motif visualization; Authors - Jianheng Liu
human	WB	Mol Cell; Base-resolution m5C profiling across the mammalian transcriptome by bisulfite-free enzyme-assisted chemical labeling approach; Authors - Liang Lu
human	WB	Nat Chem Biol; Activity-based RNA-modifying enzyme probing reveals DUS3L-mediated dihydrouridylation.; Authors - Wei Dai ; KD Validated
human	WB	Cell Death Dis; m5C-dependent cross-regulation between nuclear reader ALYREF and writer NSUN2 promotes urothelial bladder cancer malignancy through facilitating RABL6/TK1 mRNAs splicing and stabilization; Authors - Ning Wang
human	RIP,IHC	Phytomedicine; Niujiao Dihuang Jiedu decoction promotes SLC7A11 m5C methylation modification against ferroptosis in acute-on-chronic liver failure; Authors - Liqiao Huang
rat	WB	Cell Death Discov; The NSUN5-FTH1/FTL pathway mediates ferroptosis in bone marrow-derived mesenchymal stem cells.; Authors - Jie Liu ; KD Validated