NSUN5 Recombinant monoclonal antibody, PBS Only (Detector)

NSUN5 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84768-2-PBS
Clone No.242168D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

NOL1-related protein, NOL1R, NOL1, EC:2.1.1.-, 28S rRNA (cytosine-C(5))-methyltransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84768-2-PBS targets NSUN5 as part of a matched antibody pair:

MP01548-1: 84768-1-PBS capture and 84768-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7711

Product name: Recombinant human NSUN5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 117-466 aa of BC008084

Sequence: RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT

Predict reactive species
Full Name NOL1/NOP2/Sun domain family, member 5
Calculated Molecular Weight 47 kDa
Observed Molecular Weight47~51 kDa
GenBank Accession NumberBC008084
Gene Symbol NSUN5
Gene ID (NCBI) 55695
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96P11
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NSUN5 is a conserved RNA methyltransferase belonging to the Nop2/SUN domain family, which is highly conserved from archaea to eukaryotes and has close contact with RNA methylation because of their S-adenosyl methionine binding-domain. NSUN5 was a promoter in the progression of CRC mainly through cell cycle regulation (PMID: 32774740). Loss of NSUN5 induces growth phenotypes in mice and different mammalian cells, which is likely connected to the requirement of NSUN5 for ribosomal RNA modification and normal global protein translation, especially in highly proliferative cells (PMID: 31722427). Western blot analysis detected NSUN5 at an apparent molecular mass of 47 kDa.

Loading...
||
New chat Able
正在加载,请稍候...