NT5C3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NT5C3 Polyclonal antibody, PBS Only (11393-1-PBS)

• 

  WB analysis of human skeletal muscle using 11393-1-AP (same clone as 11393-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11393-1-AP (NT5C3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse placenta using 11393-1-AP (same clone as 11393-1-PBS)

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 11393-1-AP (NT5C3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 11393-1-AP (same clone as 11393-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11393-1-AP (NT5C3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 11393-1-AP (same clone as 11393-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11393-1-AP (NT5C3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 11393-1-AP (same clone as 11393-1-PBS)

  IP result of anti-NT5C3 (IP:11393-1-AP, 4ug; Detection:11393-1-AP 1:500) with mouse kidney tissue lysate 3000 ug. This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11393-1-AP (same clone as 11393-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11393-1-AP (NT5C3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11393-1-PBS in a different storage buffer formulation.

NT5C3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11393-1-PBS targets NT5C3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1949

  Product name: Recombinant human NT5C3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-297 aa of BC015856

  Sequence: MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

• Full Name: 5'-nucleotidase, cytosolic III
• Calculated Molecular Weight: 297 aa, 34 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC015856
• Gene Symbol: NT5C3
• Gene ID (NCBI): 51251
• RRID: AB_2267361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0P0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.