Product Information
31739-1-PBS targets NT5DC2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35015 Product name: Recombinant human NT5DC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 195-265 aa of NM_022908 Sequence: LLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLF Predict reactive species |
| Full Name | 5'-nucleotidase domain containing 2 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 60-65 kDa |
| GenBank Accession Number | NM_022908 |
| Gene Symbol | NT5DC2 |
| Gene ID (NCBI) | 64943 |
| RRID | AB_3742467 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9H857 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
5'-Nucleotidase domain containing 2 (NT5DC2) is a member of the NT5DC family and contains a haloacid dehalogenase motif localized in the N-terminus of these proteins (PMID: 32962856). NT5DC2 is associated with attention-deficit/hyperactivity disorder and bipolar disorder. NT5DC2 has been shown to interact with and stabilize Fyn, a Src family proto-oncogene, and plays a role in regulating glioblastoma progression. NT5DC2 promotes tumor cell proliferation by stabilizing EGFR in hepatocellular carcinoma (PMID: 32382041).
