NT5M Polyclonal antibody

• 

  WB analysis using 20765-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20765-1-AP (NT5M antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 20765-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20765-1-AP (NT5M antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 20765-1-AP

  IP result of anti-NT5M (IP:20765-1-AP, 4ug; Detection:20765-1-AP 1:600) with mouse skeletal muscle tissue lysate 2200ug.

NT5M Polyclonal Antibody for WB, IP, ELISA

Cat No. 20765-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IP, ELISA

Synonyms

5'(3')-deoxyribonucleotidase, mitochondrial, 5',3'-nucleotidase, mitochondrial, Deoxy-5'-nucleotidase 2, dNT 2, DNT2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue
• Positive IP detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20765-1-AP targets NT5M in WB, IP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14743

  Product name: Recombinant human NT5M protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-228 aa of BC035838

  Sequence: LRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC

• Full Name: 5',3'-nucleotidase, mitochondrial
• Calculated Molecular Weight: 228 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC035838
• Gene Symbol: NT5M
• Gene ID (NCBI): 56953
• RRID: AB_10733338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPB1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NT5M is a mitochondrial 5′(3′)-deoxyribonucleotidase that plays a crucial role in maintaining balanced deoxynucleotide pools essential for mitochondrial DNA synthesis. It dephosphorylates specific nucleoside monophosphates, particularly dUMP and dTMP, thereby preventing the accumulation of toxic dTTP. NT5M is predominantly localized in mitochondria and is highly expressed in tissues such as the heart, brain, and skeletal muscle.