NTN3 Polyclonal antibody

• 

  WB analysis using 31893-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31893-1-AP (NTN3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NTN3 Polyclonal Antibody for WB, ELISA

Cat No. 31893-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

NTN2L, Netrin-3, Netrin-2-like protein, netrin 3, Netrin 2 like protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31893-1-AP targets NTN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34435

  Product name: Recombinant human NTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-207 aa of Netrin-3

  Sequence: DPCHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDS

• Full Name: netrin 3
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 62-70 kDa
• GenBank Accession Number: Netrin-3
• Gene Symbol: NTN3
• Gene ID (NCBI): 4917
• RRID: AB_3670136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00634
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NTN3 (Netrin-3), also known as NTN2L. NTN3 (Netrin-3) is predicted to be located in the Golgi apparatus and extracellular region, and it is also predicted to be active in the basement membrane. It is detected in various amounts in the skin, esophagus, bronchus, nasal cavity, kidney, and vagina in healthy human tissues (PMID: 37345154). The protein is predicted to enable signaling receptor binding activity and is involved in animal organ morphogenesis, neuron projection development, and tissue development. Netrins, including NTN3, are a group of proteins that exhibit structural homology to the extracellular matrix protein laminin and influence neurological and tumor progression. NTN3, along with other netrin family members, may play a role in tumor growth and migration in specific organs where they are expressed, potentially affecting disease progression. However, further research is needed to elucidate the precise prognostic and biological implications of NTN3 in various diseases, including cancer (PMID: 32251318). The molecular weight of NTN3 is 62 kDa. It is possible that the protein has glycosylation modification.