TrkA Recombinant monoclonal antibody

• 

  WB analysis of K-562 using 83477-7-RR

  K-562 cells were subjected to SDS PAGE followed by western blot with 83477-7-RR (TrkA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 83477-7-RR

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 83477-7-RR (TrkA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83477-7-RR

  Biolayer interferometry (BLl) kinetic assays of 83477-7-RR against Human NTRK1 were performed. The affinity constant is below 1 pM.

TrkA Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83477-7-RR

Clone No.240440D12

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NTRK1, Trk A, TRK, p140 TrkA, MTC

---

Tested Applications

• Positive WB detected in: K-562 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83477-7-RR targets TrkA in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32759

  Product name: Recombinant human NTRK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 537-796 aa of NM_001007792

  Sequence: DKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG

• Full Name: neurotrophic tyrosine kinase, receptor, type 1
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_001007792
• Gene Symbol: NTRK1
• Gene ID (NCBI): 4914
• RRID: AB_3671106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P04629
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NTRK1(Neurotrophic tyrosine kinase receptor 1) is located on chromosome 1q23.1 and is responsible for a rare genetic disorder, CIPA (congenital insensitivity to pain with anhidrosis) (PMID: 37907480). As a neurotrophin receptor, NTRK1 is abundantly expressed in human neuronal tissues and plays an integral role in the development and function of the human nervous system (PMID: 27843590). NTRK1 also regulates the survival and proliferation of cholinergic neurons (PMID: 20054812).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Reyes (Verified Customer) (10-06-2025)

TRKA (in green) marked some cells of human brain cortex, although not the NeuN-positive neurons (in red)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Human Brain Cortex

TrkA Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:83477-7-RR)