NTS Polyclonal antibody

• 

NTS Polyclonal Antibody for ELISA

Cat No. 10932-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

neurotensin, Neurotensin/neuromedin N, NN, NT, NT Tail peptide, NT/N, NTS, NTS1

---

Product Information

10932-1-AP targets NTS in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1368

  Product name: Recombinant human NTS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC010918

  Sequence: MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

• Full Name: neurotensin
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: BC010918
• Gene Symbol: NTS
• Gene ID (NCBI): 4922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30990
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.