NUAK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUAK2 Polyclonal antibody, PBS Only (31718-1-PBS)

• 

  WB analysis using 31718-1-AP (same clone as 31718-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31718-1-AP (NUAK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31718-1-PBS in a different storage buffer formulation.

NUAK2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31718-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31718-1-PBS targets NUAK2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35302

  Product name: Recombinant human NUAK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10005287 of NM_030952

  Sequence: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT

• Full Name: NUAK family, SNF1-like kinase, 2
• Calculated Molecular Weight: 70kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_030952
• Gene Symbol: NUAK2
• Gene ID (NCBI): 81788
• RRID: AB_3670095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H093
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUAK2, also known as OMPHK2 and SNARK, is the fourth member of the AMPK kinase family. The molecular mass of NUAK2 is 69 kDa and it plays a key role in neural tube closure during embryonic development (PMID: 32845958).