NUBP1 Polyclonal antibody

• 

  WB analysis using 18011-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18011-1-AP (NUBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18011-1-AP

  WB result of NUBP1 antibody (18011-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NUBP1 transfected HeLa cells.

• 

  IP experiment of Jurkat using 18011-1-AP

  IP result of anti-NUBP1 (IP:18011-1-AP, 4ug; Detection:18011-1-AP 1:300) with Jurkat cells lysate 3600ug.

• 

  IHC staining of human stomach using 18011-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NUBP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18011-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Nucleotide binding protein 1, Nbp35, NBP1, NBP 1, NBP

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, LNCaP cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

18011-1-AP targets NUBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12510

  Product name: Recombinant human NUBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-309 aa of BC100290

  Sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS

• Full Name: nucleotide binding protein 1 (MinD homolog, E. coli)
• Calculated Molecular Weight: 309 aa, 33 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC100290
• Gene Symbol: NUBP1
• Gene ID (NCBI): 4682
• RRID: AB_2935446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53384
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Autophagy supports mitochondrial metabolism through the regulation of iron homeostasis in pancreatic cancer; Authors - Subhadip Mukhopadhyay