NUCB2/nesfatin-1 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 83917-5-RR (same clone as 83917-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NUCB2 antibody (83917-5-RR, Clone: 241037C1 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83917-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83917-5-RR (same clone as 83917-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NUCB2/nesfatin-1 antibody (83917-5-RR, Clone: 241037C1 ) at dilution of 1:500 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 83917-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83917-5-RR (same clone as 83917-5-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug NUCB2 Recombinant antibody (83917-5-RR, Clone:241037C1) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83917-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83917-5-RR (same clone as 83917-5-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NUCB2 Recombinant antibody (83917-5-RR, Clone:241037C1) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83917-5-PBS in a different storage buffer formulation.

NUCB2/nesfatin-1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83917-5-PBS

Clone No.241037C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

NUCB2, 241037C1, DNA binding protein NEFA, Gastric cancer antigen Zg4, NEFA

---

Product Information

83917-5-PBS targets NUCB2/nesfatin-1 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25152

  Product name: Recombinant human NUCB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-106 aa of NM_005013

  Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

• Full Name: nucleobindin 2
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: NM_005013
• Gene Symbol: NUCB2
• Gene ID (NCBI): 4925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P80303
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).