NUCKS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUCKS1 Polyclonal antibody, PBS Only (12023-2-PBS)

• 

  WB analysis using 12023-2-AP (same clone as 12023-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12023-2-AP (NUCKS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 12023-2-AP (same clone as 12023-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12023-2-AP (NUCKS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12023-2-AP (same clone as 12023-2-PBS)

  IP result of anti-NUCKS1 (IP:12023-2-AP, 4ug; Detection:12023-2-AP 1:600) with HEK-293 cells lysate 960 ug. This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12023-2-AP (same clone as 12023-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12023-2-AP (NUCKS1 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat pancreas using 12023-2-AP (same clone as 12023-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 12023-2-AP (NUCKS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat pancreas using 12023-2-AP (same clone as 12023-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 12023-2-AP (NUCKS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12023-2-AP (same clone as 12023-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12023-2-AP (NUCKS1 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12023-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NUCKS1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12023-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12023-2-PBS targets NUCKS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2652

  Product name: Recombinant human NUCKS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-243 aa of BC000805

  Sequence: MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED

• Full Name: nuclear casein kinase and cyclin-dependent kinase substrate 1
• Calculated Molecular Weight: 243 aa, 27 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC000805
• Gene Symbol: NUCKS1
• Gene ID (NCBI): 64710
• RRID: AB_906407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1E3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (NUCKS1) is a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated by CDK1 and casein kinase during mitosis of the cell cycle. Phosphorylated upon DNA damage, probably by ATM or ATR. Widelyexpressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. Two isoforms of NUCKS1 exist due to alternative splicing events.