NUDCD2 Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83217-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83217-4-RR against Human NUDCD2 were performed. The affinity constant is 76.2 nM.

NUDCD2 Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83217-4-RR

Clone No.230513F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

NudCL2, NudC domain-containing protein 2, NudC domain containing 2, 230513F10

---

Product Information

83217-4-RR targets NUDCD2 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15579

  Product name: Recombinant human NUDCD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC017934

  Sequence: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK

• Full Name: NudC domain containing 2
• Calculated Molecular Weight: 157 aa, 18 kDa
• GenBank Accession Number: BC017934
• Gene Symbol: NUDCD2
• Gene ID (NCBI): 134492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WVJ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NUDCD2, also known as NudCL2, is an HSP90 cochaperone that regulates sister chromatid cohesion during mitosis. NUDCD2 also plays a role in ciliogenesis(PMID: 30368549, 34480124). NUDCD2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone(PMID: 20133715).