NUDCD2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83217-5-RR (same clone as 83217-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83217-5-RR (NUDCD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83217-5-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 83217-5-RR (same clone as 83217-5-PBS)

  WB result of NUDCD2 antibody (83217-5-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NUDCD2 transfected HEK-293 cells. This data was developed using the same antibody clone with 83217-5-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 83217-5-RR (same clone as 83217-5-PBS)

  IP result of anti-NUDCD2 (IP:83217-5-RR, 4ug; Detection:83217-5-RR 1:4000) with HepG2 cells lysate 1085 ug. This data was developed using the same antibody clone with 83217-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83217-5-RR (same clone as 83217-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NUDCD2 antibody (83217-5-RR, Clone: 230513A5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83217-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83217-5-RR (same clone as 83217-5-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NUDCD2 Recombinant antibody (83217-5-RR, Clone:230513A5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83217-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83217-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83217-5-RR against Human NUDCD2 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

NUDCD2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 83217-5-PBS

Clone No.230513A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

Synonyms

230513A5, NudC domain containing 2, NudC domain-containing protein 2, NudCL2

---

Product Information

83217-5-PBS targets NUDCD2 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15579

  Product name: Recombinant human NUDCD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC017934

  Sequence: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK

• Full Name: NudC domain containing 2
• Calculated Molecular Weight: 157 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC017934
• Gene Symbol: NUDCD2
• Gene ID (NCBI): 134492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8WVJ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUDCD2, also known as NudCL2, is an HSP90 cochaperone that regulates sister chromatid cohesion during mitosis. NUDCD2 also plays a role in ciliogenesis(PMID: 30368549, 34480124). NUDCD2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone(PMID: 20133715).