Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, Jurkat cells, PC-3 cells |
| Positive IHC detected in | human lung cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16705-1-AP targets MTH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10103 Product name: Recombinant human NUDT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC014618 Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Predict reactive species |
| Full Name | nudix (nucleoside diphosphate linked moiety X)-type motif 1 |
| Calculated Molecular Weight | 179aa,20 kDa; 197aa,23 kDa |
| Observed Molecular Weight | 18-24 kDa |
| GenBank Accession Number | BC014618 |
| Gene Symbol | MTH1 |
| Gene ID (NCBI) | 4521 |
| RRID | AB_2153822 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36639 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MTH1 antibody 16705-1-AP | Download protocol |
| IHC protocol for MTH1 antibody 16705-1-AP | Download protocol |
| WB protocol for MTH1 antibody 16705-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MTH1 Polyclonal antibody (Cat# 16705-1-AP) has 5 citations, all in WB applications. They appear in Cancer Cell International, Colloids and Surfaces B: Biointerfaces, Oncotarget, BMC Gastroenterology, and Photodiagnosis and Photodynamic Therapy. Research fields span osteosarcoma progression, mutant p53 tumor nanotherapy, MTH1 enzymatic inhibition, gastric cancer cell proliferation, and ROS-driven anti-cancer photodynamic therapy, covering both human and mouse models.
| Species | Application | Title |
|---|---|---|
Cancer Cell Int NUDT1 drives osteosarcoma progression and serves as a robust predictor of clinical outcomes.
| ||
Colloids Surf B Biointerfaces Ultrasound-triggered reactive oxygen species effector nanoamplifier for enhanced combination therapy of mutant p53 tumors. | ||
Oncotarget Farnesyl phenolic enantiomers as natural MTH1 inhibitors from Ganoderma sinense.
| ||
BMC Gastroenterol USP9X regulates the proliferation, survival, migration and invasion of gastric cancer cells by stabilizing MTH1 | ||
Photodiagnosis Photodyn Ther Cepharanthine synergizes with photodynamic therapy for boosting ROS-driven DNA damage and suppressing MTH1 as a potential anti-cancer strategy |
Reviews
What customers say
The single review for this product reports a successful Western Blot in T-cells at a 1:1000 dilution, yielding a single clean band at approximately 20 kDa. The reviewer gave it a 5-star rating, indicating strong satisfaction with the antibody's performance and specificity in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wojciech (Verified Customer) (11-05-2025) | Tested in T-cells at 1:1000 dilution. Detected a single band at ~20 kDa.
|
