NUDT13 Polyclonal antibody

• 

  WB analysis using 25912-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25912-1-AP (NUDT13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NUDT13 Polyclonal Antibody for WB, ELISA

Cat No. 25912-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Nudix motif 13, NUDT13, Protein KiSS 16

---

Tested Applications

• Positive WB detected in: MKN-45 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25912-1-AP targets NUDT13 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23186

  Product name: Recombinant human NUDT13 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-263 aa of BC046173

  Sequence: MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNVAGSKRVCPSNNIIYYPQIQVNLRELETAAWFSHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 13
• Calculated Molecular Weight: 352 aa, 40 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC046173
• Gene Symbol: NUDT13
• Gene ID (NCBI): 25961
• RRID: AB_2918097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86X67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.