NUDT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NUDT2 Polyclonal antibody (10484-1-AP)

• Featured Product
• KD/KO Validated

NUDT2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10484-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Ap4A hydrolase, Ap4Aase, APAH1, Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical], Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase

• 

  WB analysis using 10484-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10484-1-AP (NUDT2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10484-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10484-1-AP (NUDT2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10484-1-AP

  WB result of NUDT2 antibody (10484-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NUDT2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10484-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10484-1-AP (NUDT2 antibody) at dilution of 1:4000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10484-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10484-1-AP (NUDT2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 10484-1-AP

  IP result of anti-NUDT2 (IP:10484-1-AP, 4ug; Detection:10484-1-AP 1:1000) with HEK-293 cells lysate 2600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10484-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10484-1-AP (NUDT2 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10484-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10484-1-AP (NUDT2 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10484-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10484-1-AP (NUDT2 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10484-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10484-1-AP (NUDT2 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse colon tissue, mouse liver tissue, mouse spleen, mouse brain tissue, rat brain tissue, rat liver tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human breast cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10484-1-AP targets NUDT2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0743

  Product name: Recombinant human NUDT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC004926

  Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 2
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC004926
• Gene Symbol: NUDT2
• Gene ID (NCBI): 318
• RRID: AB_2153978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50583
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	WB	Oncol Rep; Knockdown of GATAD2A suppresses cell proliferation in thyroid cancer in vitro.; Authors - Zongping Wang
human	IHC	Front Oncol; The functional role of Nudt2 in human triple negative breast cancer; Authors - Rasha Abu-Rahmah
human	WB	Int J Mol Sci; Role of Nudt2 in Anchorage-Independent Growth and Cell Migration of Human Melanoma; Authors - Sana' Hidmi ; KD Validated