NUDT7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUDT7 Polyclonal antibody, PBS Only (34385-1-PBS)

• 

  WB analysis using 34385-1-AP (same clone as 34385-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34385-1-AP (NUDT7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34385-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 34385-1-AP (same clone as 34385-1-PBS)

  IP result of anti-NUDT7 (IP:34385-1-AP, 4ug; Detection:34385-1-AP 1:4000) with mouse liver tissue lysate 2480 ug. This data was developed using the same antibody clone with 34385-1-PBS in a different storage buffer formulation.

NUDT7 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 34385-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

Nucleoside diphosphate-linked moiety X motif 7, Nucleoside diphosphate-linked moiety X motif 7 (Nudix motif 7), Peroxisomal coenzyme A diphosphatase NUDT7

---

Product Information

34385-1-PBS targets NUDT7 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41199

  Product name: Recombinant human NUDT7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-172 aa of NM_001105663

  Sequence: YNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFIN

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 7
• Calculated Molecular Weight: 238aa, 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001105663
• Gene Symbol: NUDT7
• Gene ID (NCBI): 283927
• RRID: AB_3743196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C024
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Peroxisomal coenzyme A diphosphatase NUDT7, a peroxisomal Nudix hydrolase, mainly localizes to the peroxisomal matrix and catalyzes hydrolysis of CoA/acyl-CoAs, regulating lipid metabolism and CoA homeostasis (PMID: 11415433; 25110012). Its dysregulation links to diabetes, Kras-driven colorectal cancer, neurodegeneration with brain iron accumulation, and osteoarthritis (PMID: 32131398; 24847269; 30143643).