Home
Products
Primary Antibodies
NUDT8 Polyclonal antibody, PBS Only (16098-1-PBS)

Filter: AllWBIHC

WB analysis of Jurkat using 16098-1-AP (same clone as 16098-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 16098-1-AP (NUDT8 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
WB analysis using 16098-1-AP (same clone as 16098-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 16098-1-AP (NUDT8 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 16098-1-AP (same clone as 16098-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 16098-1-AP (NUDT8 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16098-1-AP (NUDT8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16098-1-AP (NUDT8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16098-1-AP (NUDT8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16098-1-AP (NUDT8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 16098-1-AP (same clone as 16098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 16098-1-AP (NUDT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16098-1-PBS in a different storage buffer formulation.

NUDT8 Polyclonal antibody, PBS Only

Name: NUDT8 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16098-1-PBS

NUDT8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16098-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.6.1.-, Mitochondrial coenzyme A diphosphatase NUDT8, Nucleoside diphosphate-linked moiety X motif 8, Nudix motif 8

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16098-1-PBS targets NUDT8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8945 Product name: Recombinant human NUDT8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC018644 Sequence: MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVSWGI Predict reactive species
Full Name	nudix (nucleoside diphosphate linked moiety X)-type motif 8
Calculated Molecular Weight	236 aa, 25 kDa
Observed Molecular Weight	25 kDa
GenBank Accession Number	BC018644
Gene Symbol	NUDT8
Gene ID (NCBI)	254552
RRID	AB_2154132
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8WV74
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

NUDT8 belongs to the Nudix hydrolase family, which is involved in intracellular metabolic processes, especially related to the decomposition and degradation of nucleotides. NUDT8 is a novel CoA diphosphohydrolase that localizes to the mitochondria and is broadly expressed in mitochondria-rich organs such as the heart, kidneys, liver, and brown adipose tissue(PMID: 31004344).