NUFIP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NUFIP2 Polyclonal antibody (17752-1-AP)

NUFIP2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17752-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

182 FIP, 82 FIP, 82 kDa FMRP-interacting protein, 82-FIP, Cell proliferation-inducing gene 1 protein

• 

  WB analysis of HeLa using 17752-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17752-1-AP (NUFIP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 17752-1-AP

  IP result of anti-NUFIP2 (IP:17752-1-AP, 4ug; Detection:17752-1-AP 1:500) with HeLa cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 17752-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17752-1-AP (NUFIP2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 17752-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17752-1-AP (NUFIP2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NUFIP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17752-1-AP targets NUFIP2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12094

  Product name: Recombinant human NUFIP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC108307

  Sequence: MEEKPGQPQPQHHHSHHHPHHHPQQQQQQPHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKPLKHEQKHTLQQHQETPKKKTGYGELNGNAGEREISLKNLSSDEATNPISRVLNGNQQVVDTSLKQTVKANTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGENQSVDKSDTIPIPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETGPGGTSRGKPAVGDMLRKSSDSKPGVSSKKFDDRPKGKHASAVASKEDSWTLFKPPPVFPVDNSSA

• Full Name: nuclear fragile X mental retardation protein interacting protein 2
• Calculated Molecular Weight: 695 aa, 76 kDa
• Observed Molecular Weight: 76-82 kDa
• GenBank Accession Number: BC108307
• Gene Symbol: NUFIP2
• Gene ID (NCBI): 57532
• RRID: AB_2878433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z417
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NUFIP2 Polyclonal antibody (Cat# 17752-1-AP) has 8 citations published in high-impact journals including Cell, Neuron, PNAS, Cell Reports, JCI Insight, Journal of Cell Biology, Neurobiology of Disease, and bioRxiv. Research fields span stress granule assembly, neurodegeneration (tauopathies, ALS/FTLD), cancer metastasis, angiogenesis and wound healing, and snoRNP biogenesis.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell; Competing Protein-RNA Interaction Networks Control Multiphase Intracellular Organization.; Authors - David W Sanders
		Neuron; Increased G3BP2-Tau interaction in tauopathies is a natural defense against Tau aggregation; Authors - Congwei Wang
mouse	IHC	Proc Natl Acad Sci U S A; Succinyl-CoA ligase ADP-forming subunit beta promotes stress granule assembly to regulate redox and drive cancer metastasis; Authors - Austin C Boese
		Cell Rep; The divergent effects of G3BP orthologs on human stress granule assembly imply a centric role for the core protein interaction network; Authors - Zhiying Yao
mouse	WB	JCI Insight; BAT-derived miR-378a-3p facilitates endothelial angiogenic function and promotes wound healing.; Authors - Yongyan Deng
human	WB	J Cell Biol; Proteomic and 3D structure analyses highlight the C/D box snoRNP assembly mechanism and its control.; Authors - Jonathan Bizarro