NUP153 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86622-1-RR (same clone as 86622-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86622-1-RR (NUP153 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86622-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02679-1

  The mean NUP153 concentration was determined to be 30.07 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load, 97.51 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load and 33.07 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02679-1

  Sandwich ELISA standard curve of MP02679-1, Human NUP153 Recombinant Matched Antibody Pair - PBS only. 86622-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag5519. 86622-2-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  IF Staining of HeLa using 86622-1-RR (same clone as 86622-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NUP153 antibody (86622-1-RR, Clone: 251519G11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86622-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86622-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86622-1-RR against Human NUP153 were performed. The affinity constant is 2.32 nM.

NUP153 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86622-1-PBS

Clone No.251519G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

153 kDa nucleoporin, HNUP153, N153, nucleoporin 153kDa, Nucleoporin Nup153

---

Product Information

86622-1-PBS targets NUP153 as part of a matched antibody pair:

MP02679-1: 86622-1-PBS capture and 86622-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5519

  Product name: Recombinant human NUP153 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1475 aa of BC052965

  Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

• Full Name: nucleoporin 153kDa
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 160-170 kDa
• GenBank Accession Number: BC052965
• Gene Symbol: NUP153
• Gene ID (NCBI): 9972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49790
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984].