NUP155 Polyclonal antibody

• 

NUP155 Polyclonal Antibody for ELISA

Cat No. 12742-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

155 kDa nucleoporin, KIAA0791, N155, nucleoporin 155kDa, Nucleoporin Nup155, NUP155

---

Product Information

12742-1-AP targets NUP155 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3638

  Product name: Recombinant human NUP155 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1043-1391 aa of BC039257

  Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

• Full Name: nucleoporin 155kDa
• Calculated Molecular Weight: 1391 aa, 155 kDa
• GenBank Accession Number: BC039257
• Gene Symbol: NUP155
• Gene ID (NCBI): 9631
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.