NUP160 Polyclonal antibody

• 

  WB analysis of HeLa using 16084-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16084-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16084-1-AP

  IP result of anti-NUP160 (IP:16084-1-AP, 4ug; Detection:16084-1-AP 1:500) with HeLa cells lysate 4000ug.

NUP160 Polyclonal Antibody for WB, IP, ELISA

Cat No. 16084-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

160 kDa nucleoporin, KIAA0197, nucleoporin 160kDa, Nucleoporin Nup160, NUP120, NUP160

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16084-1-AP targets NUP160 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9083

  Product name: Recombinant human NUP160 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC009822

  Sequence: MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSVSWLSAISFISQITLGVTNVVLERCLLELKEIWILVIPHQAYFDSYRLK

• Full Name: nucleoporin 160kDa
• Calculated Molecular Weight: 1316 aa, 149 kDa
• Observed Molecular Weight: 149 kDa
• GenBank Accession Number: BC009822
• Gene Symbol: NUP160
• Gene ID (NCBI): 23279
• RRID: AB_2157341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12769
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.