NUP160 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NUP160 Polyclonal antibody (16084-1-AP)

NUP160 Polyclonal Antibody for WB, IP, ELISA

Cat No. 16084-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, ELISA

Synonyms

160 kDa nucleoporin, KIAA0197, nucleoporin 160kDa, Nucleoporin Nup160, NUP120, NUP160

• 

  WB analysis of HeLa using 16084-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 16084-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 16084-1-AP

  IP result of anti-NUP160 (IP:16084-1-AP, 4ug; Detection:16084-1-AP 1:500) with HeLa cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NUP160 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16084-1-AP targets NUP160 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9083

  Product name: Recombinant human NUP160 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC009822

  Sequence: MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSVSWLSAISFISQITLGVTNVVLERCLLELKEIWILVIPHQAYFDSYRLK

• Full Name: nucleoporin 160kDa
• Calculated Molecular Weight: 1316 aa, 149 kDa
• Observed Molecular Weight: 149 kDa
• GenBank Accession Number: BC009822
• Gene Symbol: NUP160
• Gene ID (NCBI): 23279
• RRID: AB_2157341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12769
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NUP160 Polyclonal antibody (Cat# 16084-1-AP) has 3 citations published in Molecular Cancer, Science Advances, and Cell Death Discovery. The associated research fields include cancer biology (lung adenocarcinoma progression via autophagy suppression), personalized cancer immunotherapy (neoantigen discovery), and nuclear RNA export mechanisms (exon junction complex and nuclear pore complex regulation of lncRNA trafficking).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Mol Cancer; M6A-Methylated circRAPGEF5 drives lung adenocarcinoma progression and metastasis via IGF2BP2/NUP160-mediated autophagy suppression; Authors - Liqun Ling ; KD Validated
human	WB	Sci Adv; Immunopeptidomics-guided discovery and characterization of neoantigens for personalized cancer immunotherapy.; Authors - Yangyang Cai
		Cell Death Discov; Exon junction complex and nuclear pore complex components preferentially govern the nuclear export of spliced lncRNAs.; Authors - Sondas Saeed