Use Able AI chat for product recommendations

NUP85 Polyclonal antibody

NUP85 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

NUP75, Nucleoporin Nup85, Nucleoporin Nup75, nucleoporin 85kDa, FROUNT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for NUP85 in ?

Tested Applications

Positive WB detected inCOLO 320 cells, HepG2 cells
Positive IHC detected inrat brain tissue, human stomach cancer tissue, mouse brain tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15027-1-AP targets NUP85 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7158

Product name: Recombinant human Pericentrin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 307-656 aa of BC000697

Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS

Predict reactive species
Full Name nucleoporin 85kDa
Calculated Molecular Weight 75 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberBC000697
Gene Symbol NUP85
Gene ID (NCBI) 79902
RRIDAB_3085449
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BW27
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. NPCs are key for nucleocytoplasmic transport, but also regulate the mitotic machinery, transcription and chromatin organization through transport-independent mechanisms. The NUP107-160 complex is acknowledged to contribute to the assembly and maintenance of the NPC structure. Members of this largest subcomplex of the NPC associate with kinetochores, mitotic spindles, centrosomes and mitotic checkpoint regulators for proper completion of the cell cycle . Downregulation of NUP107-160 subcomplex members resulted in defective cytokinesis, compromised microtubule structures, altered cytoskeletal dynamics, impaired chromosome segregation and differentiation. (PMID:34170319)

Protocols

Product Specific Protocols
IF protocol for NUP85 antibody 15027-1-APDownload protocol
IHC protocol for NUP85 antibody 15027-1-APDownload protocol
WB protocol for NUP85 antibody 15027-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NUP85 Polyclonal antibody (Cat# 15027-1-AP) has 2 total citations. These appear in Colloids and Surfaces B: Biointerfaces and Pediatric Nephrology. The associated research fields include hepatocellular carcinoma treatment via tumor microenvironment remodeling using nanozymes, and the genetic/clinical spectrum of steroid-resistant nephrotic syndrome linked to nuclear pore gene mutations. Both citations involve human samples, with applications in Western blot and IHC.

SpeciesApplicationTitle
humanWB

Colloids Surf B Biointerfaces

Mannose-modified multifunctional iron-based nanozyme for hepatocellular carcinoma treatment by remodeling the tumor microenvironment

Authors - Qi Liu
humanIHC

Pediatr Nephrol

Genetic and clinical spectrum of steroid-resistant nephrotic syndrome with nuclear pore gene mutation

Authors - Huihui Yang
Loading...
||
New chat

Able™

正在加载,请稍候...