NUP85 Recombinant monoclonal antibody, PBS Only (Detector)

NUP85 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83288-1-PBS
Clone No.240116A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240116A2, 85 kDa nucleoporin, FROUNT, nucleoporin 85kDa, Nucleoporin Nup75

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83288-1-PBS targets NUP85 as part of a matched antibody pair:

MP00330-1: 83288-2-PBS capture and 83288-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7086

Product name: Recombinant human Pericentrin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 307-656 aa of BC000697

Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS

Predict reactive species
Full Name nucleoporin 85kDa
Calculated Molecular Weight 75 kDa
GenBank Accession NumberBC000697
Gene Symbol NUP85
Gene ID (NCBI) 79902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BW27
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. NPCs are key for nucleocytoplasmic transport, but also regulate the mitotic machinery, transcription and chromatin organization through transport-independent mechanisms. The NUP107-160 complex is acknowledged to contribute to the assembly and maintenance of the NPC structure. Members of this largest subcomplex of the NPC associate with kinetochores, mitotic spindles, centrosomes and mitotic checkpoint regulators for proper completion of the cell cycle . Downregulation of NUP107-160 subcomplex members resulted in defective cytokinesis, compromised microtubule structures, altered cytoskeletal dynamics, impaired chromosome segregation and differentiation. (PMID:34170319)

Loading...
||
New chat Able
正在加载,请稍候...