NUP98-NUP96 Polyclonal antibody

• 

  WB analysis using 12329-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12329-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12329-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 12329-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of COLO 320 using 12329-1-AP

  IP result of anti-NUP98-NUP96 (IP:12329-1-AP, 4ug; Detection:12329-1-AP 1:1000) with COLO 320 cells lysate 2000ug.

• 

  IHC staining of human breast cancer using 12329-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12329-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12329-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12329-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 12329-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NUP98-NUP96 antibody (12329-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NUP98-NUP96 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12329-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

NUP98 NUP96, Nuclear pore complex protein Nup98-Nup96, Nuclear pore complex protein Nup98, Nuclear pore complex protein Nup96, EC:3.4.21.-

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells
• Positive IP detected in: COLO 320 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

12329-1-AP targets NUP98-NUP96 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3016

  Product name: Recombinant human NUP98-NUP96 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1515-1817 aa of BC012906

  Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL

• Full Name: nucleoporin 98kDa
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC012906
• Gene Symbol: NUP98
• Gene ID (NCBI): 4928
• RRID: AB_10973678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52948
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuron; Nucleoporin Seh1 Interacts with Olig2/Brd7 to Promote Oligodendrocyte Differentiation and Myelination.; Authors - Zhixiong Liu
human	IF	Cell Rep; Antiviral Immune Response as a Trigger of FUS Proteinopathy in Amyotrophic Lateral Sclerosis.; Authors - Tatyana A Shelkovnikova
human	IF	Nat Commun; iU-ExM: nanoscopy of organelles and tissues with iterative ultrastructure expansion microscopy; Authors - Vincent Louvel
pig	WB	Int J Biol Macromol; Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection; Authors - Mingyang Li
Mouse		Nat Commun; BOOST: a robust ten-fold expansion method on hour-scale; Authors - Jinyu Guo