Tested Applications
| Positive WB detected in | COLO 320 cells, Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12329-1-AP targets NUP98-NUP96 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3016 Product name: Recombinant human NUP98-NUP96 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1515-1817 aa of BC012906 Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL Predict reactive species |
| Full Name | nucleoporin 98kDa |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 105 kDa |
| GenBank Accession Number | BC012906 |
| Gene Symbol | NUP98 |
| Gene ID (NCBI) | 4928 |
| RRID | AB_10973678 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| IHC protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| IP protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| WB protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NUP98-NUP96 Polyclonal antibody (Cat# 12329-1-AP) has 11 citations across journals including Nature Communications, Neuron, Cell Death Discovery, Cell Reports, Communications Biology, International Journal of Biological Macromolecules, Journal of Proteome Research, Biomedical Optics Express, and Science Advances. Research fields span expansion microscopy/nanoscopy, nucleoporin and nuclear pore function, oligodendrocyte myelination, lncRNA nuclear export, innate immune responses to viral infection, FUS proteinopathy in ALS, esophageal cancer proteomics, and nuclear envelope reassembly.
| Species | Application | Title |
|---|---|---|
Nat Commun iU-ExM: nanoscopy of organelles and tissues with iterative ultrastructure expansion microscopy | ||
Neuron Nucleoporin Seh1 Interacts with Olig2/Brd7 to Promote Oligodendrocyte Differentiation and Myelination. | ||
Cell Death Discov Exon junction complex and nuclear pore complex components preferentially govern the nuclear export of spliced lncRNAs. | ||
Int J Biol Macromol Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection |
