NUPL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NUPL1 Polyclonal antibody (19907-1-AP)

NUPL1 Polyclonal Antibody for WB, ELISA

Cat No. 19907-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA0410, nucleoporin like 1, Nucleoporin like protein 1, Nucleoporin p58/p45, NUPL1, PRO2463

• 

  WB analysis of HepG2 using 19907-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 19907-1-AP (NUPL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 19907-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 19907-1-AP (NUPL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 19907-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 19907-1-AP (NUPL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 19907-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 19907-1-AP (NUPL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NUPL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, L02 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19907-1-AP targets NUPL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13901

  Product name: Recombinant human NUPL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-599 aa of BC001104

  Sequence: VICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR

• Full Name: nucleoporin like 1
• Calculated Molecular Weight: 599 aa, 61 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC001104
• Gene Symbol: NUPL1
• Gene ID (NCBI): 9818
• RRID: AB_10694673
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVL2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NUPL1 Polyclonal antibody (catalog number 19907-1-AP) has 2 total citations. These appear in Nature Physics (2024), covering nuclear pore protein transport and structural anisotropy, and eLife (2018), addressing nuclear pore heterogeneity, HIV-1 infection, and MX2 antiviral activity. Both studies used the antibody for Western blot (WB), with the eLife work performed in human samples. The associated research fields include nuclear pore biology, protein transport, and virology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Phys; Structural anisotropy results in mechano-directional transport of proteins across nuclear pores; Authors - Fani Panagaki
human	WB	Elife; Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2.; Authors - Melissa Kane