NXF3 Polyclonal antibody

• 

  IHC staining of human gliomas using 13275-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 13275-1-AP (NXF3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human gliomas using 13275-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 13275-1-AP (NXF3 antibody) at dilution of 1:50 (under 40x lens).

NXF3 Polyclonal Antibody for IHC, ELISA

Cat No. 13275-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

nuclear RNA export factor 3, NXF3, TAP like protein 3, TAPL 3, TAPL3

---

Tested Applications

• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13275-1-AP targets NXF3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3998

  Product name: Recombinant human NXF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC031616

  Sequence: MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSILELF

• Full Name: nuclear RNA export factor 3
• Calculated Molecular Weight: 531 aa, 60 kDa
• GenBank Accession Number: BC031616
• Gene Symbol: NXF3
• Gene ID (NCBI): 56000
• RRID: AB_2877933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4D5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Life Sci; Nuclear translocation of CDK5RAP3 regulated by NXF3 promotes the progression of gastric cancer; Authors - Cheng Zhang
		Sci Transl Med; A cell-penetrant peptide blocking C9ORF72-repeat RNA nuclear export reduces the neurotoxic effects of dipeptide repeat proteins; Authors - Lydia M Castelli