NXPE4 Polyclonal antibody

• 

  WB analysis using 32297-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32297-1-AP (NXPE4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

NXPE4 Polyclonal Antibody for WB, ELISA

Cat No. 32297-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C11orf33, FAM55D

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32297-1-AP targets NXPE4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35198

  Product name: Recombinant human NXPE4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 285-435 aa of NM_001077639.1

  Sequence: MEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEYFKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKYCYPLIGSMTYSVKEMEYLTRAIDRTGGEKNTVIVISL

• Full Name: family with sequence similarity 55, member D
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_001077639.1
• Gene Symbol: FAM55D
• Gene ID (NCBI): 54827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UWF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NXPE4, also known as FAM55D and C11orf33, belongs to thNeurexophilin family. NXPE4 was down-regulated when TNFAIP3, a key regulator in inflammatory bowel disease (IBD), was knocked down, and IBD are closely associated with the incidence of CRC. Thus, NXPE4 may be a key factor in the pathogenesis of IBD and CRC (PMID: 31297877).