NXT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NXT2 Polyclonal antibody, PBS Only (12136-1-PBS)

• 

  IHC staining of human colon cancer using 12136-1-AP (same clone as 12136-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12136-1-AP (NXT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12136-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12136-1-AP (same clone as 12136-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12136-1-AP (NXT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12136-1-PBS in a different storage buffer formulation.

NXT2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 12136-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

12136-1-PBS targets NXT2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2782

  Product name: Recombinant human NXT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-197 aa of BC014888

  Sequence: TREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS

• Full Name: nuclear transport factor 2-like export factor 2
• Calculated Molecular Weight: 197 aa, 23 kDa
• GenBank Accession Number: BC014888
• Gene Symbol: NXT2
• Gene ID (NCBI): 55916
• RRID: AB_2158284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPJ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NXT2 is a member of NXT family proteins that are generally involved in exporting nuclear RNA in eukaryotic cells. The function of NXT2 has not been widely studied, and is yet to be fully elucidated.