CoraLite®555-conjugated NeuN Polyclonal antibody

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. CL555-26975

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF-P, FC (Intra)

cDNA FLJ56884, FLJ56884, FLJ58356, FOX3, hCG_1776007, Homo sapiens (Human), HRNBP3, NeuN, RBFOX3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inU-87 MG cells
Positive FC detected inU-87 MG cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-26975 targets NeuN in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25689

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
Observed Molecular Weight 46-52 kDa
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
RRIDAB_2919647
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
Excitation LaserGreen Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA6NFN3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Function

NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).

Tissue specificity

NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).

Involvement in disease

· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).

Isoforms

There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).

Post-translational modifications

Currently not known.

Cellular localization

NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).


Protocols

Product Specific Protocols
IF protocol for CL555 NeuN antibody CL555-26975Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...