Neutrophil Elastase Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Neutrophil Elastase Recombinant monoclonal antibody (85965-5-RR)

Neutrophil Elastase Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85965-5-RR

Clone No.253414H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ELA2, ELANE, EC:3.4.21.37, Elastase 2, HLE

• 

  WB analysis of U-937 using 85965-5-RR

  U-937 cells were subjected to SDS PAGE followed by western blot with 85965-5-RR (ELA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 85965-5-RR

  HL-60 cells were subjected to SDS PAGE followed by western blot with 85965-5-RR (ELA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 85965-5-RR

  Biolayer interferometry (BLI) kinetic assays of 85965-5-RR against Human Neutrophil Elastase were performed. The affinity constant is 2.51 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85965-5-RR targets Neutrophil Elastase in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag39624

  Product name: Recombinant human ELA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-267 aa of NM_001972.4

  Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 29KD
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001972.4
• Gene Symbol: ELA2
• Gene ID (NCBI): 1991
• RRID: AB_3744512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.