Nir2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Nir2 Polyclonal antibody (26983-1-AP)

• Featured Product
• KD/KO Validated

Nir2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26983-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

DRES9, NIR 2, NIR2, PITPNM, PITPnm 1, PITPNM1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1

• 

  WB analysis of HepG2 using 26983-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26983-1-AP (Nir2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 26983-1-AP

  IP result of anti-Nir2 (IP:26983-1-AP, 4ug; Detection:26983-1-AP 1:500) with HeLa cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Nir2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26983-1-AP targets Nir2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25357

  Product name: Recombinant human PITPNM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1158-1243 aa of BC022230

  Sequence: LSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE

• Full Name: phosphatidylinositol transfer protein, membrane-associated 1
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC022230
• Gene Symbol: Nir2
• Gene ID (NCBI): 9600
• RRID: AB_2880712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00562
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The antibody (Cat# 26983-1-AP) targeting Nir2 has 6 total citations. Citations appear in Nature Chemical Biology, Biochimica et Biophysica Acta Molecular Cell Research, Journal of Virology, Journal of Biological Chemistry, bioRxiv, and eLife. Research fields span lipid homeostasis, lipid-transfer protein function in endothelial cells, hepatitis C virus replication, nuclear p53-phosphoinositide signaling, and sphingomyelin synthesis. Applications include Western blotting, co-immunoprecipitation, and immunofluorescence.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Membrane editing with proximity labeling reveals regulators of lipid homeostasis.; Authors - Reika Tei
human	CoIP	Biochim Biophys Acta Mol Cell Res; The role of Nir2, a lipid-transfer protein, in regulating endothelial cell functions; Authors - Zydrune Polianskyte-Prause
human	WB	J Virol; Nir2 Is an Effector of VAPs Necessary for Efficient Hepatitis C Virus Replication and Phosphatidylinositol 4-Phosphate Enrichment at the Viral Replication Organelle.; Authors - Hongliang Wang ; KO Validated
human	WB	J Biol Chem; Lipid Transfer Proteins and PI4KIIα Initiate Nuclear p53-Phosphoinositide Signaling.; Authors - Noah D. Carrillo
human		Elife; The ORP9-ORP11 dimer promotes sphingomyelin synthesis; Authors - Birol Cabukusta
human	IF,WB	bioRxiv; Lipid transfer proteins initiate nuclear phosphoinositide signaling; Authors - Noah D Carrillo