Use Able AI chat for product recommendations

NLRP3 Polyclonal antibody

NLRP3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 30109-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA, Western Blot

AGTAVPRL, AII/AVP, Mmig1, MWS, NALP3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLPS treated RAW 264.7 cells, J774A.1 cells, rat spleen tissue, LPS and Brefeldin A treated NR8383 cells, RAW 264.7 cells
Positive IP detected inRAW 264.7 cells
Positive IF/ICC detected inHepG2 cells, RAW 264.7 cells

NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30109-1-AP targets NLRP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA, Western Blot applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken, zebrafish, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32515

Product name: Recombinant mouse NLRP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-153 aa of NM_145827

Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Predict reactive species
Full Name NLR family, pyrin domain containing 3
Calculated Molecular Weight118kd
Observed Molecular Weight108-120 kDa
GenBank Accession NumberNM_145827
Gene Symbol Nlrp3
Gene ID (NCBI) 216799
RRIDAB_3086231
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8R4B8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death (PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa. An additional 130-135 kDa band could also be detected (PMID: 17164409; PMID: 34680443; PMID: 35585627). This antibody is specific for mouse NLRP3.

Protocols

Product Specific Protocols
IF protocol for NLRP3 antibody 30109-1-APDownload protocol
IP protocol for NLRP3 antibody 30109-1-APDownload protocol
WB protocol for NLRP3 antibody 30109-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse,humanWB

Autophagy

PPARG activation by pioglitazone promotes mitophagy and inhibits the NLRP3 inflammasome to alleviate arthritic joint inflammation and bone damage.

Authors - Tingting Fu

Nat Commun

Antioxidant lipid nanoparticles enhance mRNA stability for regeneration therapy and gene editing.

Authors - Benhao Li
mouseIF

Nat Commun

PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis.

Authors - Li Zhao
mouseWB

ACS Nano

Engineered Bacteria-Driven Biohybrid Microrobots Potentiate IL-2 Immunotherapy by Evoking Pyroptosis.

Authors - Ping Li
ratWB,IHC

J Adv Res

PTPN22 as a therapeutic target in intervertebral disc degeneration: Modulating mitophagy and pyroptosis through the PI3K/AKT/mTOR axis

Authors - Haibo Liang
mouseIF

J Adv Res

Engineering a multifunctional nanoplatform with cascade catalytic and bidirectional immunomodulatory capacities for integrating sepsis therapy.

Authors - Yao Xiao

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Luca (Verified Customer) (05-17-2026)

Used for Western blot, signal clear with no aspecific bands

  • Applications: Western Blot

Luca (Verified Customer) (03-27-2026)

Antibody used for WB in A549 cells, good signal combined with fluorescent secondary antibody (IRDye800)

  • Applications: Western Blot
  • Cell Tissue Type: A549
Loading...
||
New chat

Able

正在加载,请稍候...