Noxa Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Noxa Polyclonal antibody, PBS Only (17418-1-PBS)

• 

  WB analysis using 17418-1-AP (same clone as 17418-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17418-1-AP (Noxa antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17418-1-PBS in a different storage buffer formulation.

Noxa Polyclonal Antibody for WB, ELISA

Cat No. 17418-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PMAIP1, APR, Immediate-early-response protein APR, Phorbol-12-myristate-13-acetate-induced protein 1, PMA induced protein 1

---

Product Information

17418-1-PBS targets Noxa in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11387

  Product name: Recombinant human NOXA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC032663

  Sequence: MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN

• Full Name: phorbol-12-myristate-13-acetate-induced protein 1
• Calculated Molecular Weight: 136 aa, 15 kDa
• Observed Molecular Weight: 6-15 kDa
• GenBank Accession Number: BC032663
• Gene Symbol: NOXA
• Gene ID (NCBI): 5366
• RRID: AB_3669271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13794
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.