Nurim Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Nurim Polyclonal antibody, PBS Only (27009-1-PBS)

• 

  WB analysis using 27009-1-AP (same clone as 27009-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27009-1-AP (Nurim antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27009-1-PBS in a different storage buffer formulation.

Nurim Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27009-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

NRM, NRM29

---

Product Information

27009-1-PBS targets Nurim in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25501

  Product name: Recombinant human NRM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC039865

  Sequence: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQR

• Full Name: nurim (nuclear envelope membrane protein)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC039865
• Gene Symbol: NRM
• Gene ID (NCBI): 11270
• RRID: AB_3742209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXM6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nurim (nuclear envelope membrane protein) is also known as NRM and NRM29. Its primary cellular localization is the inner nuclear membrane (INM), where it is tightly associated with the nucleus. Nurim has emerged as a crucial regulator of apoptosis suppression.