OAS2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OAS2 Polyclonal antibody (19279-1-AP)

• Featured Product
• KD/KO Validated

OAS2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 19279-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

(2-5')oligo(A) synthase 2, 2-5A synthase 2, 2'-5'-oligoadenylate synthase 2, EC:2.7.7.84

• 

  WB analysis using 19279-1-AP

  IFN alpha treated A549 cells were subjected to SDS PAGE followed by western blot with 19279-1-AP (OAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 19279-1-AP

  WB result of OAS2 antibody (19279-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-OAS2 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 19279-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19279-1-AP (OAS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 19279-1-AP

  IP result of anti-OAS2 (IP:19279-1-AP, 4ug; Detection:19279-1-AP 1:500) with Jurkat cells lysate 2280 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 19279-1-AP (OAS2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 19279-1-AP (OAS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 19279-1-AP (OAS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19279-1-AP (OAS2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19279-1-AP (OAS2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 19279-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 19279-1-AP (OAS2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OAS2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: IFN alpha treated A549 cells, Daudi cells, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human colon cancer, human breast cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19279-1-AP targets OAS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6170

  Product name: Recombinant human OAS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 335-687 aa of BC049215

  Sequence: VLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPVKVI

• Full Name: 2'-5'-oligoadenylate synthetase 2, 69/71kDa
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 66-71 kDa
• GenBank Accession Number: BC049215
• Gene Symbol: OAS2
• Gene ID (NCBI): 4939
• RRID: AB_10642832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29728
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS2, are IFN-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS2 is also named as p69 OAS / p71 OAS. It has 3 isoforms(71/69/20 kDa) produced by alternative splicing. The OAS2 isozymes are 69-71 kDa and form dimers(PMID:17765707). Glycosylation is essential for its activity(PMID:9880569). Constitutive expression of the 69-kDa form of the OAS2 protein in human cells inhibited the replication of encephalomyocarditis virus (EMCV) but not that of VSV, Sendai virus, or reovirus(PMID:16501108). This antibody is specific to isoform p71 and isoform p69 of OAS2.

Publications

What published studies show

The anti-OAS2 antibody (Cat# 19279-1-AP) has 30 citations spanning journals including Science, Immunity, Nature Cell Biology, Nature Communications, Science Immunology, Molecular Cell, Science Advances, EMBO Journal, and others. Research fields covered include antiviral innate immunity, interferon signaling, OAS-RNase L pathway, cancer (glioblastoma, pancreatic and lung carcinoma), autoimmune diseases (lupus, psoriasis, Sjögren syndrome), diabetes, and RNA biology. Applications are predominantly WB, IF, and IHC in human and mouse samples.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; A prenylated dsRNA sensor protects against severe COVID-19.; Authors - Arthur Wickenhagen
human	WB	Science; Inborn errors of OAS-RNase L in SARS-CoV-2-related multisystem inflammatory syndrome in children; Authors - Danyel Lee
mouse	WB	Immunity; OAS cross-activates RNase L intercellularly through cell-to-cell transfer of 2-5A to spread innate immunity; Authors - Wanwan Huai
human	WB	Nat Cell Biol; Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes; Authors - Dario F De Jesus
		Nat Commun; ATP functions as a pathogen-associated molecular pattern to activate the E3 ubiquitin ligase RNF213; Authors - Juraj Ahel
human	WB	Nat Commun; Decoding non-canonical mRNA decay by the endoplasmic-reticulum stress sensor IRE1α; Authors - Adrien Le Thomas